General Information

  • ID:  hor006529
  • Uniprot ID:  P0C2P6
  • Protein name:  Soricidin
  • Gene name:  NA
  • Organism:  Blarina brevicauda (Northern short-tailed shrew)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  Salivary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Blarina (genus), Soricinae (subfamily), Soricidae (family), Eulipotyphla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005246 calcium channel regulator activity; GO:0090729 toxin activity; GO:0099106 ion channel regulator activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DCSQDCAACSILARPAELNTETCILECEGKLSSNDTEGGLCKEFLHPSKVDLPR
  • Length:  54(1-54)
  • Propeptide:  DCSQDCAACSILARPAELNTETCILECEGKLSSNDTEGGLCKEFLHPSKVDLPR
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Paralytic toxin that immobilizes a mealworm for 7 days (Ref.1). Inhibits the transient receptor potential cation channel subfamily V member 6 (TRPV6) (Ref.2).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-23; 6-27; 9-41
  • Structure ID:  AF-P0C2P6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P0C2P6-F1.pdbhor006529_AF2.pdbhor006529_ESM.pdb

Physical Information

Mass: 675811 Formula: C241H394N68O86S6
Absent amino acids: MWY Common amino acids: LCE
pI: 4.23 Basic residues: 6
Polar residues: 19 Hydrophobic residues: 15
Hydrophobicity: -30.93 Boman Index: -10138
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 77.78
Instability Index: 5382.22 Extinction Coefficient cystines: 375
Absorbance 280nm: 7.08

Literature

  • PubMed ID:  23554944
  • Title:  In vivo detection of human TRPV6-rich tumors with anti-cancer peptides derived from soricidin.
  • PubMed ID:  28150073
  • Title:  First-in-human phase I study of SOR-C13, a TRPV6 calcium channel inhibitor, in patients with advanced solid tumors.
  • PubMed ID:  28389981
  • Title:  Erratum to: First-in-human phase I study o
  • PubMed ID:  30210643
  • Title: